Shanghai Twochem Hot Sale High Purity Calcitonin Salmon CAS 47931-85-1 Peptide 5mg 10mg Vials with Safe and Fast Delivery Best Price Stock

Product Details
Customization: Available
CAS No.: 47931-85-1
Formula: C145h240n44o48s2
Still deciding? Get samples of US$ 1/Bag
Request Sample
Gold Member Since 2024

Suppliers with verified business licenses

Audited Supplier

Audited by an independent third-party inspection agency

Fast Delivery
The supplier can deliver the goods within 15 days
Low MOQ
The MOQ for the supplier's products is 1
Full Customization
The supplier provides full customization services
Minor Customization
The supplier provides minor customization services such as logo, graphic, package
to see all verified strength labels (7)
  • Shanghai Twochem Hot Sale High Purity Calcitonin Salmon CAS 47931-85-1 Peptide 5mg 10mg Vials with Safe and Fast Delivery Best Price Stock
  • Shanghai Twochem Hot Sale High Purity Calcitonin Salmon CAS 47931-85-1 Peptide 5mg 10mg Vials with Safe and Fast Delivery Best Price Stock
  • Shanghai Twochem Hot Sale High Purity Calcitonin Salmon CAS 47931-85-1 Peptide 5mg 10mg Vials with Safe and Fast Delivery Best Price Stock
  • Shanghai Twochem Hot Sale High Purity Calcitonin Salmon CAS 47931-85-1 Peptide 5mg 10mg Vials with Safe and Fast Delivery Best Price Stock
  • Shanghai Twochem Hot Sale High Purity Calcitonin Salmon CAS 47931-85-1 Peptide 5mg 10mg Vials with Safe and Fast Delivery Best Price Stock
  • Shanghai Twochem Hot Sale High Purity Calcitonin Salmon CAS 47931-85-1 Peptide 5mg 10mg Vials with Safe and Fast Delivery Best Price Stock
Find Similar Products
  • Overview
  • Our Advantages
  • Product Description
  • Application
  • Company Profile
  • Factory display
Overview

Basic Info.

Model NO.
TAPI-280
Type
Pharmaceutical Intermediates
Appearance
Powder
Quality
Industrial
Colour
White
Grade Standard
Pharmaceutical Grade
Shelf Life
2 Years Proper Storage
Color
White Powder
Storage
Cool Dry Place
Model
Tapi-280
Application
Functional Ingridents
CAS
47931-85-1
Test
HPLC
Assay
99%
Sample
Avaliable
MW
3431.85
Transport Package
Standard Packaging or Customized to Your Needs
Specification
1KG 5KG 25KG 50KG
Trademark
Twochem
Origin
Zhejiang Province
HS Code
2930909099
Production Capacity
5000kg/Year

Product Description

 
Shanghai Twochem Hot Sale High Purity Calcitonin Salmon CAS 47931-85-1 Peptide 5mg 10mg Vials with Safe and Fast Delivery Best Price Stock


 
Our Advantages

Shanghai Twochem Hot Sale High Purity Calcitonin Salmon CAS 47931-85-1 Peptide 5mg 10mg Vials with Safe and Fast Delivery Best Price Stock1.Free Samples.
2.MOQ:500g.
3.More than 3000 kinds of animal drugs.
4.More than 11+ manufacturing experience.
5.Certification:MSDS,HALAL,COA,IFRA,ISO9001, ISO22000,26 Allergens, etc.
6.Lead time:about 8-12 working days.
8.Verified by Made-in-China as Golden Supplier.




 
Product Description

Shanghai Twochem Hot Sale High Purity Calcitonin Salmon CAS 47931-85-1 Peptide 5mg 10mg Vials with Safe and Fast Delivery Best Price Stock
 
 
What is Calcitonin salmon CAS 47931-85-1 ?
 
 

Calcitonin (salmon) is an hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes.

Calcitonin contains a single disulfide bond, which causes the amino terminus to assume the shape of a ring. Alternative splicing of the calcitonin pre-mRNA can yield a mRNA encoding calcitonin gene-related peptide; that peptide appears to function in the nervous and vascular systems.

The calcitonin receptor has been cloned and shown to be a member of the seven-transmembrane, G protein-coupled receptor family.

 
Name: Calcitonin Acetate(Salmon)
Cas No: 47931-85-1(net)
Formula: C145H240N44O48S2
Molecular: 3431.85
Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Calcihexal, Calcimar, Cibacalcin, Fortical, Miacalcin, Salcatonin,
Pramlintide, Pramlintide acetate [USAN],187887-46-3,196078-30-5.
Purity:98%
Source: synthetic
Appearance: White Lyophilized Powder
Minimum Order Quantity: 1 g
Brand Name: Yinherb
Test Method: HPLC
Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18° C. Upon reconstitution of the peptide it should be stored at 4° C between 2-21 days and for future use below-18° C. 


 
Shanghai Twochem Hot Sale High Purity Calcitonin Salmon CAS 47931-85-1 Peptide 5mg 10mg Vials with Safe and Fast Delivery Best Price Stock
Application

 

 
Shanghai Twochem Hot Sale High Purity Calcitonin Salmon CAS 47931-85-1 Peptide 5mg 10mg Vials with Safe and Fast Delivery Best Price Stock
 
 
Company Profile
 
 
 
Shanghai Twochem Hot Sale High Purity Calcitonin Salmon CAS 47931-85-1 Peptide 5mg 10mg Vials with Safe and Fast Delivery Best Price Stock
 
 
 
ShangHai Twochem is one of professional groups specialized in research, development, custom manufacturing and trading of pharmaceutical API, advanced intermediates, food supplements, hookah additive flavors ,Cosmetic raw materials, health and cosmetic raw materials, polypeptides, animal drug and organic reagent  etc. You can select more than 2000 kinds of raw ingredients here. And we are keeping developing new products and continuously marketing them for sale. You will save lots of time , energy, money and have a very pleasant cooperation with us! We have cooperated with local Medicine Inspection Center as our QC center. We have customer manufacture sites managed under GMP guidline in Anhui and Jiangsu Province, China. We have good relationship with many pharmaceutical research Institute and Universities in China. 


 
Factory display

 

 

Shanghai Twochem Hot Sale High Purity Calcitonin Salmon CAS 47931-85-1 Peptide 5mg 10mg Vials with Safe and Fast Delivery Best Price Stock

 

 

Shanghai Twochem Hot Sale High Purity Calcitonin Salmon CAS 47931-85-1 Peptide 5mg 10mg Vials with Safe and Fast Delivery Best Price Stock

 

 

Q&A

1.How could l get a sample?
Before we received the first order, please afford the sample cost and express fee. We wilreturn  the sample cost back to you within your first order.

2.Can you make designs for us?
We have a professional design team to help our customers do design work.Both OEM and ODM          orders are accepted.

3.Can we get samples from your factory?
We can provide you samples for free, you just pay express cost.

4.Whether you could make our brand on your products?
Yes. We can print your Logo on both the products and the packages if you can meet our MOQ
How can you provide us high quality products?


5.We have a professional QC team, every product is shipped after strictly examination.
What is your lead time?

Quantity about 10000 pcs is 15-20 days ,small orders are about one week.
Huge orders to be neqotiated.


6.What is your payment?
We accept T/T.L/C.Westem union or to be negotiated.Don't worry about anything, if you have      any problems, please feel free to contact us

 
 
 
 

Send your message to this supplier

*From:
*To:
*Message:

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now
Contact Supplier
People who viewed this also viewed