1.Free Samples.
2.MOQ:500g.
3.More than 3000 kinds of animal drugs.
4.More than 11+ manufacturing experience.
5.Certification:MSDS,HALAL,COA,IFRA,ISO9001, ISO22000,26 Allergens, etc.
6.Lead time:about 8-12 working days.
8.Verified by Made-in-China as Golden Supplier.
What is Calcitonin salmon CAS 47931-85-1 ?
Calcitonin (salmon) is an hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes.
Calcitonin contains a single disulfide bond, which causes the amino terminus to assume the shape of a ring. Alternative splicing of the calcitonin pre-mRNA can yield a mRNA encoding calcitonin gene-related peptide; that peptide appears to function in the nervous and vascular systems.
The calcitonin receptor has been cloned and shown to be a member of the seven-transmembrane, G protein-coupled receptor family.
Name: Calcitonin Acetate(Salmon)
Cas No: 47931-85-1(net)
Formula: C145H240N44O48S2
Molecular: 3431.85
Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Calcihexal, Calcimar, Cibacalcin, Fortical, Miacalcin, Salcatonin,
Pramlintide, Pramlintide acetate [USAN],187887-46-3,196078-30-5.
Purity:98%
Source: synthetic
Appearance: White Lyophilized Powder
Minimum Order Quantity: 1 g
Brand Name: Yinherb
Test Method: HPLC
Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18° C. Upon reconstitution of the peptide it should be stored at 4° C between 2-21 days and for future use below-18° C.
ShangHai Twochem is one of professional groups specialized in research, development, custom manufacturing and trading of pharmaceutical API, advanced intermediates, food supplements, hookah additive flavors ,Cosmetic raw materials, health and cosmetic raw materials, polypeptides, animal drug and organic reagent etc. You can select more than 2000 kinds of raw ingredients here. And we are keeping developing new products and continuously marketing them for sale. You will save lots of time , energy, money and have a very pleasant cooperation with us! We have cooperated with local Medicine Inspection Center as our QC center. We have customer manufacture sites managed under GMP guidline in Anhui and Jiangsu Province, China. We have good relationship with many pharmaceutical research Institute and Universities in China.


Q&A
1.How could l get a sample?
Before we received the first order, please afford the sample cost and express fee. We wilreturn the sample cost back to you within your first order.
2.Can you make designs for us?
We have a professional design team to help our customers do design work.Both OEM and ODM orders are accepted.
3.Can we get samples from your factory?
We can provide you samples for free, you just pay express cost.
4.Whether you could make our brand on your products?
Yes. We can print your Logo on both the products and the packages if you can meet our MOQ
How can you provide us high quality products?
5.We have a professional QC team, every product is shipped after strictly examination.
What is your lead time?
Quantity about 10000 pcs is 15-20 days ,small orders are about one week.
Huge orders to be neqotiated.
6.What is your payment?
We accept T/T.L/C.Westem union or to be negotiated.Don't worry about anything, if you have any problems, please feel free to contact us